PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00056.1.g01270.1.am.mkhc
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family bZIP
Protein Properties Length: 447aa    MW: 48103.6 Da    PI: 6.9765
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00056.1.g01270.1.am.mkhcgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_134.35e-11248306563
                                     CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                          bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                                     kr++r   NR +A rs +RK  +i+eLe+kv++L++e ++L  +l +l+   + l+se+
  Zjn_sc00056.1.g01270.1.am.mkhc 248 KRAKRILANRQSAARSKERKMRYIAELERKVQTLQTEATTLTTQLAMLQRDTSGLTSEN 306
                                     9************************************************9999999987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.3E-17244308IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.151246309IPR004827Basic-leucine zipper domain
PfamPF001701.9E-9248306IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1702.9E-11248304No hitNo description
SuperFamilySSF579596.19E-11248302No hitNo description
CDDcd147032.24E-22249298No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 447 aa     Download sequence    Send to blast
QRGDHSRPIF LRGVNFSVKA QREHVFLHLA PPPPPPPAPL VSLPHPHAPA PPPLRLRPAA  60
SITQISMDET PTVDPAASAS TSTSAAGETA ASRDVAAMLP NSPPRRGAGH RRAQSEILLG  120
GALPDDLTFD ADLGVVGEAG RDEYEEDDDE DEEECPGGSG AGSSSRMFEM FLENNGGLAE  180
PTEPSPHQHQ QVSPAAPPAR PRHQHSMSMD GSTSLGSTSA GMAGRSGADA KKAISDAKLA  240
ELALVDPKRA KRILANRQSA ARSKERKMRY IAELERKVQT LQTEATTLTT QLAMLQRDTS  300
GLTSENSDLK MRVQSMEQQV RLQDALNDRL RDKIQQLKIA TGQVNTNIGK MGNFGLSSYG  360
GNPKSYQRTQ IQSLLAAQQL QQLQIHSQSQ HQQQQTHLQQ HLSTAQQHQL LQEALPFPGD  420
LKMKGLATTS LSQNAGASDG HAVNSEP
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004976085.11e-155PREDICTED: transcription factor RF2a-like
SwissprotQ040889e-83POF21_ARATH; Probable transcription factor PosF21
TrEMBLC0PDU91e-161C0PDU9_MAIZE; BZIP transcription factor
STRINGGRMZM2G112483_P011e-160(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP123022937
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06070.12e-63bZIP family protein